General Information

  • ID:  hor004656
  • Uniprot ID:  Q9LUA1(36-91)
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 27
  • Gene name:  CLE27
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE27p]: Mostly expressed in apex, and, to a lower extent, in roots, leaves, flowers and siliques.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  AIRIFPETPASGKRQEEDLMKKYFGAGKFPPVDSFVGKGISESKRIVPSCPDPLHN
  • Length:  56(36-91)
  • Propeptide:  MTHAREWRSSLTTTLLMVILLSYMLHLFCVYSRVGAIRIFPETPASGKRQEEDLMKKYFGAGKFPPVDSFVGKGISESKRIVPSCPDPLHN
  • Signal peptide:  MTHAREWRSSLTTTLLMVILLSYMLHLFCVYSRVG
  • Modification:  T48 Hydroxyproline;T51 Hydroxyproline
  • Glycosylation:  T51 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LUA1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004656_AF2.pdbhor004656_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 715528 Formula: C278H437N75O80S2
Absent amino acids: W Common amino acids: PK
pI: 9.29 Basic residues: 10
Polar residues: 14 Hydrophobic residues: 16
Hydrophobicity: -56.43 Boman Index: -10069
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 62.68
Instability Index: 7243.04 Extinction Coefficient cystines: 1490
Absorbance 280nm: 27.09

Literature

  • PubMed ID:  30114285
  • Title:  The Signaling Peptide-Encoding Genes CLE16, CLE17 and CLE27 Are Dispensable for Arabidopsis Shoot Apical Meristem Activity